| CAMPSQ1646 |
| Title : |
Defensin Tk-AMP-D5 |
| GenInfo Identifier : |
147641211 |
| Source : |
Triticum kiharae [Wheat] |
| Taxonomy : |
Plantae |
| UniProt: |
P84966 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted |
| InterPro : |
IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
46 |
Sequence: |
RECRSESKKFVGLCVSDTNCASVCLTERFPGGKCDGYRRCFCTKDC |