CAMPSQ1634
Title : Beta-defensin 1
GenInfo Identifier : 47115610
Source : Papio anubis [Olive baboon]
Taxonomy : Animalia, Mammals
UniProt: P61262
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0019898 Cellular component Extrinsic component of membrane ISS
GO:1990742 Cellular component Microvesicle ISS
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042802 Molecular function Identical protein binding ISS
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IEA
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0002227 Biological process Innate immune response in mucosa IEA
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 36
Sequence:
DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India