CAMPSQ163
Title : Defensin-like peptide
GenInfo Identifier : 156630496
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: P85215
PubMed : 17194500
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
S. lutea ( MIC = 1.4-1.9 microM), P. pastoris ( MIC = 1.4-2.9 microM), P. stipitis ( MIC = 2.9 microM), Z. marxianus ( MIC = 1.4-2.9 microM), P. tannophilus ( MIC = 1.4-2.9 microM), C. albicans ( MIC = 1.4-2.9 microM), C. fructus ( MIC = 1.4-2.9 microM), C. wickerhamii ( MIC = 2.9 microM), A. niger ( MIC = 1.4-2.9 microM), T. harzianum ( MIC = 1.4-2.9 microM)
Validated : Experimentally validated
Comment : Inactive against M. luteus, L. monocytogenes, E. coli D31, E. coli ATCC 25922, S. typhimurium, S.cerevisiae, S.pombe, C.albidus, F.oxysporum
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India