CAMPSQ16220
Title : Neutrophil antibiotic peptide NP-3B
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia
UniProt: Q9Z1F1
Activity : Antimicrobial
Validated : Predicted (Based on signature)
InterPro : IPR016327 : Alpha-defensin.
IPR016327 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
IPR002366 : Defensin_propep.
IPR002366 :
IPR006081 : Mammalian_defensins.
IPR006081 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH33_12 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Extracellular space IBA
GO:0019731 Antibacterial humoral response IBA
GO:0061844 Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Cellular response to lipopolysaccharide IBA
GO:0050832 Defense response to fungus IEA
GO:0050829 Defense response to Gram-negative bacterium IBA
GO:0050830 Defense response to Gram-positive bacterium IBA
GO:0002227 Innate immune response in mucosa IBA
GO:0031640 Killing of cells of other organism IEA
GO:0051673 Membrane disruption in other organism IBA
Length : 87
Sequence:
 MRTLILLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCS
CRTSSCRFGERLSGACRLNGRIYRLCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India