CAMPSQ1622
Title : Beta-defensin 1
GenInfo Identifier : 3023390
Source : Ovis aries [Sheep]
Taxonomy : Animalia, Mammals
UniProt: O19038
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0019898 Cellular component Extrinsic component of membrane ISS
GO:1990742 Cellular component Microvesicle ISS
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042802 Molecular function Identical protein binding ISS
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 42
Sequence:
 QGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India