CAMPSQ16193
Title : Defensin-like protein 17
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Plantae
UniProt: Q9FI22
Activity : Antimicrobial
Validated : Predicted
InterPro : IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 80
Sequence:
MAKSATIITFLFAALVLFAAFEAPTMVEAQKLCEKPSGTWSGVCGNSNACKNQCINLEGA
KHGSCNYVFPAHKCICYVPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India