CAMPSQ16170
Title : Ranatuerin-2P
Source : Lithobates pipiens [Northern leopard frog]
Taxonomy : Animalia
UniProt: Q8QFQ4
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Ranatuerin
Signature :
ID Type Pattern / HMM
BrevininH_224 HMM
OcellatinH_18 HMM
BrevininH22_2 HMM
BrevininH29_11 HMM
BrevininH31_4 HMM
BrevininH33_60 HMM
BrevininH37_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 71
Sequence:
 MFTMKKSLLLFFFLGTISLSLCEQERGADEDDGVEITEEEVKRGLMDTVKNVAKNLAGHM
LDKLKCKITGC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India