CAMPSQ16150
Title : Gallinacin-9
Source : Gallus gallus [Chicken]
Taxonomy : Animalia
UniProt: Q6QLR1
Activity : Antimicrobial
Validated : Predicted
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cytoplasm IDA
GO:0005615 Extracellular space IDA
GO:0031731 CCR6 chemokine receptor binding IBA
GO:0042056 Chemoattractant activity IBA
GO:0060326 Cell chemotaxis IBA
GO:0042742 Defense response to bacterium IBA
GO:0050832 Defense response to fungus IEA
GO:0050829 Defense response to Gram-negative bacterium IDA
GO:0031640 Killing of cells of other organism IEA
Length : 67
Sequence:
 MRILFFLVAVLFFLFQAAPAYSQEDADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKC
CKWAPSS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India