CAMPSQ1615
Title : Beta-defensin 8
GenInfo Identifier : 52782746
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q91V82
PDB: 1E4R
Structure Database : CAMPST499
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target :
S.aureus, P.aeruginosa, E.coli , B.cepacia
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH34_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0045087 Biological process Innate immune response IMP
Length : 35
Sequence:
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India