CAMPSQ16121
Title : Maximins 4/H3 type 6
Source : Bombina maxima [Giant fire-bellied toad]
Taxonomy : Animalia
UniProt: Q58T62
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF05298 : Bombinin ( Bombinin )
InterPro : IPR007962 : Bombinin.
IPR007962 :
AMP Family : Maximin
Signature :
ID Type Pattern / HMM
MaximinH_43 HMM
MaximinH20_18 HMM
MaximinH25_3 HMM
MaximinH27_19 HMM
MaximinP20_18 Pattern G-P-V-[IL]-[GS]-x-[IV]-[GS]-[DEGNS]-[APTV]-L-[DG]-[DG]-[LV]-[IL]
MaximinP27_19 Pattern I-G-x(2)-[FIL]-[IL]-[GS]-[AGV]-[GLV]-[KR]-x(2)-[FLV]-[KR]-[CG]-[AGL]-x(3)-[FL]-A-x(2)-[FHY]-[ALV]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 139
Sequence:
MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRGIGGVLLSAGKAALKGL
AKVLAEKYANGKRTAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQDEIAKEKRIL
GPVLGLVGNALGGLIKKIG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India