CAMPSQ16081
Title : Hemocyte defensin Cg-Defh2
Source : Crassostrea gigas [Pacific oyster]
Taxonomy : Animalia
UniProt: Q20A05
Activity : Antimicrobial
Validated : Predicted
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0016020 Membrane IEA
GO:0008289 Lipid binding IEA
GO:0042742 Defense response to bacterium IEA
GO:0045087 Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane IEA
GO:0044218 Cellular component Other organism cell membrane IEA
GO:0008289 Molecular function Lipid binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 60
Sequence:
 LLTLAVLLMVSADMAFAGFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India