CAMPSQ15988
Title : Beta-defensin 1
Source : Macaca fascicularis [Crab-eating macaque]
Taxonomy : Animalia
UniProt: P61261
Activity : Antimicrobial
Validated : Predicted
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Extracellular space IEA
GO:0019898 Extrinsic component of membrane ISS
GO:1990742 Microvesicle ISS
GO:0097225 Sperm midpiece ISS
GO:0031731 CCR6 chemokine receptor binding ISS
GO:0042802 Identical protein binding ISS
GO:0019731 Antibacterial humoral response IEA
GO:0061844 Antimicrobial humoral immune response mediated by antimicrobial peptide IEA
GO:0035584 Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 CAMP-mediated signaling ISS
GO:0050829 Defense response to Gram-negative bacterium ISS
GO:0050830 Defense response to Gram-positive bacterium ISS
GO:0002227 Innate immune response in mucosa IEA
GO:0060474 Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 68
Sequence:
MRTSYLLLFTLCLLLSEMASGDNFLTGLGHRSDHYNCVRSGGQCLYSACPIYTRIQGTCY
HGKAKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India