CAMPSQ15975
Title : Beta-defensin 1
Source : Homo sapiens [Human]
Taxonomy : Animalia
UniProt: P60022
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0070062 Extracellular exosome HDA
GO:0005576 Extracellular region TAS
GO:0005615 Extracellular space IDA
GO:0019898 Extrinsic component of membrane IDA
GO:0005796 Golgi lumen TAS
GO:1990742 Microvesicle IDA
GO:0097225 Sperm midpiece IDA
GO:0031731 CCR6 chemokine receptor binding IDA
GO:0042802 Identical protein binding IDA
GO:0019731 Antibacterial humoral response IDA
GO:0061844 Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0035584 Calcium-mediated signaling using intracellular calcium source IDA
GO:0019933 CAMP-mediated signaling IDA
GO:0006935 Chemotaxis TAS
GO:0042742 Defense response to bacterium IMP
GO:0050829 Defense response to Gram-negative bacterium IMP
GO:0050830 Defense response to Gram-positive bacterium IDA
GO:0007186 G protein-coupled receptor signaling pathway TAS
GO:0006955 Immune response TAS
GO:0045087 Innate immune response ISS
GO:0002227 Innate immune response in mucosa IDA
GO:0060474 Positive regulation of flagellated sperm motility involved in capacitation IMP
GO:0009617 Response to bacterium IDA
GO:0070062 Cellular component Extracellular exosome HDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0019898 Cellular component Extrinsic component of membrane IDA
GO:0005796 Cellular component Golgi lumen TAS
GO:1990742 Cellular component Microvesicle IDA
GO:0097225 Cellular component Sperm midpiece IDA
GO:0031731 Molecular function CCR6 chemokine receptor binding IDA
GO:0042802 Molecular function Identical protein binding IDA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source IDA
GO:0019933 Biological process CAMP-mediated signaling IDA
GO:0006935 Biological process Chemotaxis TAS
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0007186 Biological process G protein-coupled receptor signaling pathway TAS
GO:0006955 Biological process Immune response TAS
GO:0045087 Biological process Innate immune response ISS
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation IMP
GO:0009617 Biological process Response to bacterium IDA
Length : 68
Sequence:
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
RGKAKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India