CAMPSQ15934
Title : Gallinacin-2
Source : Gallus gallus [Chicken]
Taxonomy : Animalia
UniProt: P46158
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Extracellular space IBA
GO:0030141 Secretory granule TAS
GO:0031731 CCR6 chemokine receptor binding IBA
GO:0042056 Chemoattractant activity IBA
GO:0060326 Cell chemotaxis IBA
GO:0006952 Defense response TAS
GO:0042742 Defense response to bacterium IBA
GO:0005615 Cellular component Extracellular space IBA
GO:0030141 Cellular component Secretory granule TAS
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006952 Biological process Defense response TAS
GO:0042742 Biological process Defense response to bacterium IBA
Length : 64
Sequence:
MRILYLLFSLLFLALQVSPGLSSPRRDMLFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKW
PWNA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India