CAMPSQ15922
Title : Brevinin-1E
Source : Pelophylax lessonae [Pool frog]
Taxonomy : Animalia
UniProt: P32412
Activity : Antimicrobial
Validated : Predicted
Pfam : PF08018 : Antimicrobial_1 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012520 : Antimicrobial_frog_1.
IPR012520 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Brevinin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0044179 Biological process Hemolysis in other organism IDA
GO:0005576 Biological process Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0044179 Biological process Hemolysis in other organism IDA
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0044179 Biological process Hemolysis in another organism IDA
Length : 71
Sequence:
 MFTLKKSMLLLFFLGTINLSLCEEERDADEEERRDNPDESEVEVEKRFLPLLAGLAANFL
PKIFCKITRKC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India