CAMPSQ15915
Title : Cystatin-C
Source : Mus musculus [Mouse]
Taxonomy : Animalia
UniProt: P21460
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0030424 Axon ISO
GO:0005604 Basement membrane ISO
GO:0042995 Cell projection ISO
GO:0062023 Collagen-containing extracellular matrix HDA
GO:0043292 Contractile fiber ISO
GO:0005737 Cytoplasm ISO
GO:0005783 Endoplasmic reticulum ISO
GO:0005576 Extracellular region ISO
GO:0005615 Extracellular space HDA
GO:0005794 Golgi apparatus ISO
GO:0005764 Lysosome ISO
GO:0005771 Multivesicular body ISO
GO:0043025 Neuronal cell body ISO
GO:0031965 Nuclear membrane ISO
GO:0048471 Perinuclear region of cytoplasm ISO
GO:0005886 Plasma membrane ISO
GO:0031982 Vesicle ISO
GO:0001540 Amyloid-beta binding ISO
GO:0004869 Cysteine-type endopeptidase inhibitor activity ISO
GO:0004866 Endopeptidase inhibitor activity ISO
GO:0042802 Identical protein binding ISO
GO:0030414 Peptidase inhibitor activity ISO
GO:0002020 Protease binding ISO
GO:0060548 Negative regulation of cell death ISO
GO:0008284 Positive regulation of cell population proliferation ISO
GO:0045740 Positive regulation of DNA replication ISO
GO:0043067 Regulation of programmed cell death ISO
GO:0006979 Response to oxidative stress ISO
Length : 140
Sequence:
 MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSND
AYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQ
IYSVPWKGTHSLTKFSCKNA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India