CAMPSQ1591
Title : Cysteine-rich antifungal protein 2B
GenInfo Identifier : 1703193
Source : Sinapis alba [White mustard]
Taxonomy : Plantae
UniProt: Q10989
PubMed : 8836771
Activity : Antifungal
Validated : Predicted
InterPro : IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 52
Sequence:
 QKLCARPSGTWSSGNCRNNNACRNFCIKLEKSRHGSCNIPFPSNKCICYFPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India