CAMPSQ15909
Title : Cystatin-S
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia
UniProt: P19313
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Extracellular space IDA
GO:0030141 Secretory granule IDA
GO:0004869 Cysteine-type endopeptidase inhibitor activity IDA
GO:0002020 Protease binding IDA
GO:0048468 Cell development IEP
GO:0001906 Cell killing IDA
GO:0008285 Negative regulation of cell population proliferation IDA
GO:0010466 Negative regulation of peptidase activity IDA
GO:0046677 Response to antibiotic IEP
GO:0048678 Response to axon injury IEP
GO:0046687 Response to chromate IEP
GO:0009725 Response to hormone IEP
GO:0014070 Response to organic cyclic compound IEP
GO:0001562 Response to protozoan IEP
GO:0009611 Response to wounding IEP
GO:0009410 Response to xenobiotic stimulus IEP
GO:0007431 Salivary gland development IEP
Length : 141
Sequence:
 MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNS
DLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSF
VVHDIPWENYIVLLSSSCHSI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India