CAMPSQ15903
Title : Cystatin-C
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia
UniProt: P14841
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0030424 Axon IDA
GO:0005604 Basement membrane IDA
GO:0042995 Cell projection IDA
GO:0043292 Contractile fiber IDA
GO:0005737 Cytoplasm IDA
GO:0005783 Endoplasmic reticulum IDA
GO:0005576 Extracellular region ISO
GO:0005615 Extracellular space IDA
GO:0005794 Golgi apparatus ISO
GO:0005764 Lysosome IDA
GO:0005771 Multivesicular body IDA
GO:0043025 Neuronal cell body IDA
GO:0031965 Nuclear membrane IDA
GO:0048471 Perinuclear region of cytoplasm IDA
GO:0005886 Plasma membrane ISO
GO:0031982 Vesicle IDA
GO:0001540 Amyloid-beta binding ISO
GO:0004869 Cysteine-type endopeptidase inhibitor activity ISO
GO:0004866 Endopeptidase inhibitor activity ISO
GO:0042802 Identical protein binding ISO
GO:0030414 Peptidase inhibitor activity IDA
GO:0002020 Protease binding IDA
GO:0006915 Apoptotic process IEP
GO:0007420 Brain development IEP
GO:0001775 Cell activation IEP
GO:0070301 Cellular response to hydrogen peroxide IEP
GO:0034599 Cellular response to oxidative stress IEP
GO:0042747 Circadian sleep/wake cycle, REM sleep IEP
GO:0006952 Defense response ISO
GO:0007566 Embryo implantation IEP
GO:0001654 Eye development IEP
GO:0008584 Male gonad development IEP
GO:0060313 Negative regulation of blood vessel remodeling ISO
GO:0060548 Negative regulation of cell death IMP
GO:0010711 Negative regulation of collagen catabolic process ISO
GO:0060311 Negative regulation of elastin catabolic process ISO
GO:0010716 Negative regulation of extracellular matrix disassembly ISO
GO:0010466 Negative regulation of peptidase activity ISO
GO:0045861 Negative regulation of proteolysis ISO
GO:0008284 Positive regulation of cell population proliferation IDA
GO:0045740 Positive regulation of DNA replication IDA
GO:0043067 Regulation of programmed cell death IMP
GO:0034103 Regulation of tissue remodeling ISO
GO:0048678 Response to axon injury IEP
GO:0009743 Response to carbohydrate IEP
GO:0032355 Response to estradiol IEP
GO:0001666 Response to hypoxia IEP
GO:0010035 Response to inorganic substance IEP
GO:0031667 Response to nutrient levels IEP
GO:0014070 Response to organic cyclic compound IEP
GO:0006979 Response to oxidative stress IMP
GO:0009636 Response to toxic substance IEP
GO:0009410 Response to xenobiotic stimulus IEP
GO:0007431 Salivary gland development IEP
GO:0060009 Sertoli cell development IEP
GO:0097435 Supramolecular fiber organization ISO
Length : 140
Sequence:
 MASPLRSLMLLLAVLAVAWAGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSND
AYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ
IYSVPWKGTHTLTKSSCKNA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India