CAMPSQ15900
Title : Serotransferrin
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia
UniProt: P12346
Activity : Antimicrobial
Validated : Predicted
AMP Family : Transferrin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0016324 Apical plasma membrane ISO
GO:0045178 Basal part of cell ISO
GO:0009925 Basal plasma membrane ISO
GO:0005604 Basement membrane IDA
GO:0009986 Cell surface ISO
GO:0051286 Cell tip IDA
GO:0005905 Clathrin-coated pit ISO
GO:0031410 Cytoplasmic vesicle ISO
GO:0005769 Early endosome ISO
GO:0030139 Endocytic vesicle ISO
GO:0005768 Endosome ISO
GO:0005576 Extracellular region ISO
GO:0005615 Extracellular space IDA
GO:0031232 Extrinsic component of external side of plasma membrane ISO
GO:1990712 HFE-transferrin receptor complex ISO
GO:0005770 Late endosome ISO
GO:0016020 Membrane ISO
GO:0048471 Perinuclear region of cytoplasm ISO
GO:0005886 Plasma membrane IBA
GO:0055037 Recycling endosome ISO
GO:0031982 Vesicle ISO
GO:0008199 Ferric iron binding IDA
GO:0008198 Ferrous iron binding ISO
GO:0034986 Iron chaperone activity ISO
GO:1990459 Transferrin receptor binding ISO
GO:0007015 Actin filament organization ISO
GO:0006953 Acute-phase response IEP
GO:0019731 Antibacterial humoral response IBA
GO:0006915 Apoptotic process ISS
GO:0006879 Cellular iron ion homeostasis TAS
GO:0071320 Cellular response to cAMP IEP
GO:0071372 Cellular response to follicle-stimulating hormone stimulus IEP
GO:0071281 Cellular response to iron ion ISO
GO:0070371 ERK1 and ERK2 cascade ISO
GO:0006826 Iron ion transport IDA
GO:0030316 Osteoclast differentiation ISO
GO:0045780 Positive regulation of bone resorption ISO
GO:2000147 Positive regulation of cell motility ISO
GO:0031643 Positive regulation of myelination IDA
GO:0070447 Positive regulation of oligodendrocyte progenitor proliferation IDA
GO:0042327 Positive regulation of phosphorylation ISO
GO:0048260 Positive regulation of receptor-mediated endocytosis ISO
GO:0045893 Positive regulation of transcription, DNA-templated ISO
GO:0034756 Regulation of iron ion transport ISO
GO:0009617 Response to bacterium ISO
GO:0001666 Response to hypoxia IEP
GO:0010288 Response to lead ion IEP
GO:0014070 Response to organic cyclic compound IEP
GO:0060395 SMAD protein signal transduction ISO
Length : 698
Sequence:
 MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVK
KTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEFYGSLEHPQTHYLAVAVV
KKGTDFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLPEPRKPLEKAVASFFSGSCVPC
ADPVAFPQLCQLCPGCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTIFEVLPQKADRD
QYELLCLDNTRKPVDQYEDCYLARIPSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSKD
FQLFGSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPV
KWCALSHQERAKCDEWSVSSNGQIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQC
GLVPVMAENYDISSCTNPQSDVFPKGYYAVAVVKASDSSINWNNLKGKKSCHTGVDRTAG
WNIPMGLLFSRINHCKFDEFFSQGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAF
QCLVEKGDVAFVKHQTVLENTNGKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQ
APNHVVVSRKEKAARVSTVLTAQKDLFWKGDKDCTGNFCLFRSSTKDLLFRDDTKCLTKL
PEGTTYEEYLGAEYLQAVGNIRKCSTSRLLEACTFHKS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India