CAMPSQ15879
Title : U1-poneritoxin-Ni3b (U1-PONTX-Ni3b), (Poneratoxin), (Ponericin Pi I2)
Source : Neoponera inversa [Ant]
Taxonomy : Animalia
UniProt: P0DSJ0
Activity : Antimicrobial
Validated : Predicted (Based on signature)
AMP Family : Ponericin
Signature :
ID Type Pattern / HMM
PonericinH_18 HMM
PonericinH30_5 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0090729 Toxin activity IEA
GO:0042742 Defense response to bacterium IEA
GO:0050832 Defense response to fungus IEA
GO:0031640 Killing of cells of other organism IEA
Length : 30
Sequence:
GWRDWLKKGKEWIKAKGPGIVKAALKAAVQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India