CAMPSQ15780
Title : Cystatin-C
Source : Homo sapiens [Human]
Taxonomy : Animalia
UniProt: P01034
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005783 Endoplasmic reticulum TAS
GO:0005788 Endoplasmic reticulum lumen TAS
GO:0070062 Extracellular exosome HDA
GO:0005576 Extracellular region IMP
GO:0005615 Extracellular space IDA
GO:1904813 Ficolin-1-rich granule lumen TAS
GO:0005794 Golgi apparatus IDA
GO:0005886 Plasma membrane IDA
GO:1904724 Tertiary granule lumen TAS
GO:0001540 Amyloid-beta binding IPI
GO:0004869 Cysteine-type endopeptidase inhibitor activity IDA
GO:0004866 Endopeptidase inhibitor activity IDA
GO:0042802 Identical protein binding IPI
GO:0030414 Peptidase inhibitor activity IDA
GO:0002020 Protease binding IPI
GO:0006952 Defense response IDA
GO:0060313 Negative regulation of blood vessel remodeling IEP
GO:0010711 Negative regulation of collagen catabolic process IEP
GO:0060311 Negative regulation of elastin catabolic process IMP
GO:0010716 Negative regulation of extracellular matrix disassembly IEP
GO:0010466 Negative regulation of peptidase activity IDA
GO:0045861 Negative regulation of proteolysis IDA
GO:0034103 Regulation of tissue remodeling IEP
GO:0097435 Supramolecular fiber organization IGI
Length : 146
Sequence:
 MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India