CAMPSQ15777
Title : Cystatin-F
Source : Mus musculus [Mouse]
Taxonomy : Animalia
UniProt: O89098
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cytoplasm IDA
GO:0031410 Cytoplasmic vesicle IMP
GO:0005783 Endoplasmic reticulum IMP
GO:0005768 Endosome ISO
GO:0005615 Extracellular space IDA
GO:0005794 Golgi apparatus IDA
GO:0005770 Late endosome IMP
GO:0005764 Lysosome IMP
GO:0005771 Multivesicular body ISO
GO:0004869 Cysteine-type endopeptidase inhibitor activity IMP
GO:0030414 Peptidase inhibitor activity IDA
GO:0042803 Protein homodimerization activity ISO
GO:0006955 Immune response IEA
GO:0097340 Inhibition of cysteine-type endopeptidase activity IMP
GO:1903979 Negative regulation of microglial cell activation IMP
GO:0010466 Negative regulation of peptidase activity IDA
GO:0031643 Positive regulation of myelination IMP
Length : 144
Sequence:
 MWLAILLALCCLTSDTHGARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFN
NCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRT
LYCYSEVWVIPWLHSFEVPVLLCQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India