CAMPSQ15771
Title : Cystatin-F
Source : Homo sapiens [Human]
Taxonomy : Animalia
UniProt: O76096
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0031410 Cytoplasmic vesicle IDA
GO:0005783 Endoplasmic reticulum IDA
GO:0005768 Endosome IDA
GO:0005615 Extracellular space IDA
GO:0005794 Golgi apparatus IDA
GO:0005770 Late endosome IBA
GO:0005764 Lysosome IDA
GO:0005771 Multivesicular body IDA
GO:0004869 Cysteine-type endopeptidase inhibitor activity IBA
GO:0004866 Endopeptidase inhibitor activity TAS
GO:0030414 Peptidase inhibitor activity IDA
GO:0042803 Protein homodimerization activity IDA
GO:0006955 Immune response TAS
GO:0097340 Inhibition of cysteine-type endopeptidase activity IBA
GO:1903979 Negative regulation of microglial cell activation IBA
GO:0010466 Negative regulation of peptidase activity IDA
GO:0031643 Positive regulation of myelination IBA
Length : 145
Sequence:
 MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKF
NNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQ
TLSCYSEVWVVPWLQHFEVPVLRCH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India