CAMPSQ15765
Title : Cystatin-C
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia
UniProt: O19092
Activity : Antimicrobial
Validated : Predicted
AMP Family : Cystatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Extracellular space IBA
GO:0005794 Golgi apparatus IEA
GO:0005886 Plasma membrane IEA
GO:0001540 Amyloid-beta binding IEA
GO:0004869 Cysteine-type endopeptidase inhibitor activity IEA
GO:0042802 Identical protein binding IEA
GO:0002020 Protease binding IEA
GO:0006952 Defense response IEA
GO:0060313 Negative regulation of blood vessel remodeling IEA
GO:0010711 Negative regulation of collagen catabolic process IEA
GO:0060311 Negative regulation of elastin catabolic process IEA
GO:0010716 Negative regulation of extracellular matrix disassembly IEA
GO:0097435 Supramolecular fiber organization IEA
Length : 146
Sequence:
 MAGPLRAPLLLLAILAVALAVSPAAGASPGKPPRLVGGPMDASVEEEGVRRALDFAVSEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHEQPHLKRK
AFCSFQIYTVPWQGTMTLSKSTCQDA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India