CAMPSQ15722
Title : Brevinin-2HS2A
Source : Odorrana hainanensis [Odor frog]
Taxonomy : Animalia
UniProt: E7EKE0
Activity : Antimicrobial
Validated : Predicted
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Brevinin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 75
Sequence:
 MFTLKKPLLLLFFLGTISLSLCQEERDADEEEGEMIEEEVKRSLLGTVKDLLIGAGKSAA
QSVLKGLSCKLSKDC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India