CAMPSQ15547
Title : Ocellatin-PT2
Source : Leptodactylus pustulatus [Ceara white-lipped frog]
Taxonomy : Animalia
UniProt: C0HJZ7
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF08110 : Antimicrobial15 ( Ocellatin family )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
AMP Family : Ocellatin
Signature :
ID Type Pattern / HMM
OcellatinH_18 HMM
OcellatinH21_3 HMM
OcellatinH22_4 HMM
OcellatinH25_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0006952 Defense response IEA
GO:0019836 Hemolysis by symbiont of host erythrocytes IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response IEA
GO:0019836 Biological process Hemolysis by symbiont of host erythrocytes IEA
Length : 66
Sequence:
MAFLKKSLFLVLFLGLVSLSICDEEKRQDEDDDDDDDEEKRGVFDIIKDAGKQLVAHATG
KIAEKV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India