CAMPSQ15529
Title : Thionin NsW1 (Fragment)
Source : Nigella sativa [Black cumin]
Taxonomy : Plantae
UniProt: C0HJH9
Activity : Antimicrobial
Validated : Predicted (Based on signature)
AMP Family : Thionin
Signature :
ID Type Pattern / HMM
ThioninH_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0090729 Toxin activity IEA
GO:0001897 Cytolysis by symbiont of host cells IDA
GO:0050832 Defense response to fungus IDA
GO:0050830 Defense response to Gram-positive bacterium IDA
Length : 35
Sequence:
 KSCCKNTLGRNCYNTCRFMKKPRKTCSGLCGCKIS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India