CAMPSQ15496
Title : Dermaseptin-PT9
Source : Phyllomedusa tarsius [Brownbelly leaf frog]
Taxonomy : Animalia
UniProt: A0A5P9NYS6
Activity : Antimicrobial
Validated : Predicted (Based on signature)
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH_57 HMM
DermaseptinH25_8 HMM
DermaseptinH26_4 HMM
DermaseptinH28_12 HMM
DermaseptinH32_4 HMM
DermaseptinH33_3 HMM
DermaseptinP25_8 Pattern G-[IL]-x-[DS]-x-[IL]-K-[DEN]-[ALV]-[AG]-K-[AET]-A-[AG]-x(2)-A-x(3)-[AV]-x-[DEG]-x-[ALV]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0016020 Membrane IEA
GO:0042742 Defense response to bacterium IEA
GO:0050832 Defense response to fungus IEA
GO:0045087 Innate immune response IEA
GO:0031640 Killing of cells of other organism IEA
Length : 71
Sequence:
 MAFLKKSLFLVLFLGLVSLSICEEEKRENEMEQEDDEQSEMKRGLWSKIKDAAKTAGKAA
LGFVNEMVGEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India