CAMPSQ15494
Title : Dermaseptin-SP4
Source : Agalychnis spurrelli [Gliding leaf frog]
Taxonomy : Animalia
UniProt: A0A5P9K6A8
Activity : Antimicrobial
Validated : Predicted (Based on signature)
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH_57 HMM
DermaseptinH25_8 HMM
DermaseptinH27_5 HMM
DermaseptinH28_12 HMM
DermaseptinH32_4 HMM
DermaseptinP27_5 Pattern A-[AG]-x(2)-A-L-N-A-V-x-[GV]-x-[ALV]-N
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Extracellular region IEA
GO:0016020 Membrane IEA
GO:0042742 Defense response to bacterium IEA
GO:0050832 Defense response to fungus IEA
GO:0044179 Hemolysis in other organism IEA
GO:0045087 Innate immune response IEA
Length : 75
Sequence:
 MAFLKKSLFLVLFLGLVSLSMCEEEKRENEVEEEQEDDEQSELRRSLWSSIKDMAAAAGR
AALNAVNGILNPGEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India