CAMPSQ1521
Title : Dermaseptin PD-2-2
GenInfo Identifier : 13959337
Source : Pachymedusa dacnicolor [Giant mexican leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: O93452
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF12121 : DD_K ( Dermaseptin )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
IPR022731 : Dermaseptin.
IPR022731 :
AMP Family : Dermaseptin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 31
Sequence:
ALWKTLLKKVGKVAGKAVLNAVTNMANQNEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India