CAMPSQ131
Title : Neutrophil cationic peptide 2 precursor
GenInfo Identifier : 1352227
Source : Cavia porcellus [Guinea pig]
Taxonomy : Animalia, Mammals
UniProt: P49112
PubMed : 8173076
Activity : Antibacterial, Antifungal, Antiviral
Gram Nature : Gram +ve, Gram -ve
Target :
S. aureus, E. coli
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR016327 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
IPR002366 : Defensin_propep.
IPR002366 :
IPR006081 : Mammalian_defensins.
IPR006081 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0051607 Biological process Defense response to virus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 31
Sequence:
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India