CAMPSQ1302
Title : Opistoporin4
GenInfo Identifier : 37594698
Source : Opistophthalmus carinatus [African yellow leg scorpion]
Taxonomy : Animalia, Arachnida
UniProt: Q5VJS9
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Hemolytic Activity :
Weak hemolytic activity against human RBCs
Validated : Predicted
Pfam : PF08102 : Antimicrobial_7 ( Scorpion antimicrobial peptide )
InterPro : IPR012526 : Antimicrobial_7.
IPR012526 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0006811 Biological process Ion transport IEA
Length : 44
Sequence:
GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India