CAMPSQ1288
Title : Penaeidin-3c
GenInfo Identifier : 3024418
Source : Litopenaeus vannamei [Whiteleg shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: P81060
PubMed : 9353298
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target :
M.luteus, E.coli, N.crassa , F.oxysporum
Validated : Predicted
Pfam : PF05927 : Penaeidin ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
IPR009226 :
AMP Family : Penaeidin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm IEA
GO:0008061 Molecular function Chitin binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 61
Sequence:
QVYKGGYTRPIPRPPFVRPVPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGY
S

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India