CAMPSQ1277
Title : Beta defensin-6-like antimicrobial peptide
GenInfo Identifier : 125662767
Source : Anas platyrhynchos [Domestic duck]
Taxonomy : Animalia, Aves
UniProt: A3FPG7
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
Length : 36
Sequence:
DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India