CAMPSQ1246
Title : Hyphancin-3D
GenInfo Identifier : 1705741
Source : Hyphantria cunea [Fall webworm moth]
Taxonomy : Animalia, Insects
UniProt: P50720
Activity : Antibacterial
Validated : Predicted
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 35
Sequence:
RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKAL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India