CAMPSQ12194
Title : OsTHION15
Source : Oryza sativa [Rice]
Taxonomy : Plantae, Angiosperms
PubMed : 30028233
Activity : Antibacterial, Antifungal
Gram Nature : Gram -ve
Target :
X. oryzae pv. oryzae (MIC = 112.6microg/ml), P. carotovorum pv. atroseptica (MIC = 14.1microg/ml), X. campestris pv. glycines, Fusarium oxysporum f. sp. cubense (7-22microg/ml), Helminthosporium oryzae (7-22microg/ml)
Validated : Experimentally validated
Comment : Activity of Recombinant Peptide is given
AMP Family : Thionin
Signature :
ID Type Pattern / HMM
ThioninH_10 HMM
Length : 116
Sequence:
QETIKVGAKSCCPTTTARNIYNACRFAHGTRERCSKLSGCKIVDGKCKPPYIHHTLHPES
EELDVLDFCMLGCTSSVCSNINTFAGNEEGNGAVERCNEACYHFCNKEADIVTIVS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India