| CAMPSQ1167 |
| Title : |
DmAMP1 |
| GenInfo Identifier : |
229890071 |
| Source : |
Dahlia merckii [Bedding dahlia] |
| Taxonomy : |
Plantae |
| UniProt: |
P0C8Y4 |
| PubMed : |
7628617 |
| Activity : |
Antifungal |
| Target : |
[Botrytis cinerea (MIC = 12 microg/ml) , Cladosporium sphaerospermum (MIC = 3 microg/ml), Fusarium culmorum (MIC = 5 microg/ml), Leptosphaeria maculans (MIC = 1.5 microg/ml), Penicillium digitatum (MIC = 2 microg/ml), Trichoderma viride (MIC >100 microg/ml), Septoria tritiei (MIC = 1 microg/ml),Verticilium albo-atrum (MIC = 4 microg/ml)-0mM CaCl2] [Botrytis cinerea (MIC >100 microg/ml) , Cladosporium sphaerospermum (MIC = 12 microg/ml), Fusarium culmorum (MIC = 8 microg/ml), Leptosphaeria maculans (MIC = 15 microg/ml), Penicillium digitatum (MIC = 70 microg/ml), Trichoderma viride (MIC >100 microg/ml), Septoria tritiei (MIC = 4 microg/ml),Verticilium albo-atrum (MIC >100 microg/ml)-1mM CaCl2 and 50mM KCl] |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
50 |
Sequence: |
ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC |