CAMPSQ1161
Title : FALL-39
GenInfo Identifier : 1706745
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P49913
PDB: 2FBS, 2FBU, 2FCG, 2K6O, 2LMF
Structure Database : CAMPST122, CAMPST560, CAMPST123, CAMPST167, CAMPST213
PubMed : 7529412
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ML-35p, Pseudomonas aeruginosa, Listeria monocytogenes , S. aureus 930918-3 , S. aureus 710A , MRSA ATCC 33591 , S. epidermidis ATCC 49741
Hemolytic Activity :
No hemolytic activity on human erythrocytes
Validated : Experimentally validated
Pfam : PF12153 : CAP18_C ( LPS binding domain of CAP18 (C terminal) )
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
IPR018216 : Cathelicidin_CS.
IPR018216 :
IPR022746 : Cathlecidin_C.
IPR022746 :
IPR046350 :
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH_140 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042995 Cellular component Cell projection IEA
GO:0070062 Cellular component Extracellular exosome HDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0042581 Cellular component Specific granule IDA
GO:0035580 Cellular component Specific granule lumen TAS
GO:1904724 Cellular component Tertiary granule lumen TAS
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071347 Biological process Cellular response to interleukin-1 IEA
GO:0071354 Biological process Cellular response to interleukin-6 IEA
GO:0071222 Biological process Cellular response to lipopolysaccharide IEA
GO:0071224 Biological process Cellular response to peptidoglycan IEA
GO:0071356 Biological process Cellular response to tumor necrosis factor IEA
GO:0002544 Biological process Chronic inflammatory response IMP
GO:0051838 Biological process Cytolysis by host of symbiont cells IDA
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0035821 Biological process Modulation of process of other organism IDA
GO:0042119 Biological process Neutrophil activation IDA
GO:0045766 Biological process Positive regulation of angiogenesis IEA
GO:0008284 Biological process Positive regulation of cell population proliferation IEA
GO:0032757 Biological process Positive regulation of interleukin-8 production IMP
GO:0001934 Biological process Positive regulation of protein phosphorylation IEA
GO:0001878 Biological process Response to yeast IDA
GO:0042995 Cellular component Cell projection IEA
GO:0070062 Cellular component Extracellular exosome HDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0042581 Cellular component Specific granule IDA
GO:0035580 Cellular component Specific granule lumen TAS
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071347 Biological process Cellular response to interleukin-1 IEA
GO:0071354 Biological process Cellular response to interleukin-6 IEA
GO:0071222 Biological process Cellular response to lipopolysaccharide IEA
GO:0071224 Biological process Cellular response to peptidoglycan IEA
GO:0071356 Biological process Cellular response to tumor necrosis factor IEA
GO:0002544 Biological process Chronic inflammatory response IMP
GO:0051838 Biological process Cytolysis by host of symbiont cells IDA
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0035821 Biological process Modulation of process of another organism IDA
GO:0042119 Biological process Neutrophil activation IDA
GO:0045766 Biological process Positive regulation of angiogenesis IEA
GO:0008284 Biological process Positive regulation of cell population proliferation IEA
GO:0032757 Biological process Positive regulation of interleukin-8 production IMP
GO:0001934 Biological process Positive regulation of protein phosphorylation IEA
GO:0001878 Biological process Response to yeast IDA
Length : 39
Sequence:
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India