CAMPSQ1118
Title : Thaumatin-like protein
GenInfo Identifier : 68064400
Source : Phaseolus vulgaris [Kidney bean]
Taxonomy : Plantae
UniProt: P83959
PubMed : 10486265
Activity : Antifungal
Target :
C.comatus, F.oxysporum, P.ostreatus
Validated : Experimentally validated
InterPro : IPR001938 : Thaumatin.
IPR001938 :
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM
ThaumatinH_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 30
Sequence:
ANFEIVNNCPYTVWAAASPGGGRRLDRGQT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India