CAMPSQ1117
Title : Theromacin
GenInfo Identifier : 74795149
Source : Theromyzon tessulatum [Duck leech]
Taxonomy : Animalia, Annelida
UniProt: Q6T6C2
PubMed : 15102860
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
M. luteus
Validated : Experimentally validated
Comment : Inactive against E. coli and F. oxysporum
Pfam : PF14865 : Macin ( Macin )
InterPro : IPR029230 :
AMP Family : Macin
Signature :
ID Type Pattern / HMM
MacinH_6 HMM
MacinP_6 Pattern C-[FWY]-[DE]-[DET]-W-S-R-C-x(3)-[ST]-[QRS]-x(2)-T-x(2)-L-[FW]-x-[DS]-C-x-[DNS]-x-C-K
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response IEA
Length : 75
Sequence:
GCFEDWSRCSPSTSRGTGVLWRDCDSYCKVCFKADRGECFDSPSLNCPQRLPNNKQCRCI
NARTAKDNRNPTCWA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India