CAMPSQ1115
Title : Cystatin-11
GenInfo Identifier : 76803548
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q9H112
PubMed : 12072414
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E. coli
Validated : Experimentally validated
Pfam : PF00031 : Cystatin ( Cystatin domain )
InterPro : IPR027214 : Cystatin.
IPR027214 :
IPR000010 : Prot_inh_cystat.
IPR000010 :
AMP Family : Cystatin
Signature :
ID Type Pattern / HMM
CystatinP_2 Pattern T-[FH]-[IL]-S-x(0,2)-E-x-[IM]-[AI]-[DV]-x-N-x-[AI]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm IMP
GO:0005576 Cellular component Extracellular region IEA
GO:0005634 Cellular component Nucleus IMP
GO:0036126 Cellular component Sperm flagellum IDA
GO:0061827 Cellular component Sperm head IDA
GO:0004869 Molecular function Cysteine-type endopeptidase inhibitor activity IEA
GO:0030521 Biological process Androgen receptor signaling pathway ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IDA
Length : 112
Sequence:
 RKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVTDHLEYHLN
VEMQWTTCQKPETTNCVPQERELHKQVNCFFSVFAVPWFEQYKILNKSCSSD

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India