CAMPSQ10980
Title : Penaeidin-3a
Source : Litopenaeus vannamei [Whiteleg shrimp]
Taxonomy : Animalia
UniProt: P81058
PubMed : 12842879
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Aerococcus viridans (MIC=0.8-1.6 microM), Micrococcus luteus (MIC=0.8-1.6 microM), Bacillus megaterium (MIC=3.12-6.25 microM); Escherichia coli 363 (MI=6.25-12.5 microM), Vibrio vulnificus (MIC >50 microM), Salmonella thyphimurium (MIC>50 microM), Klebsiella pneumoniae (MIC>50 microM), Fusarium oxysporum (MIC=3.12-6.25 microM)
Validated : Experimentally validated
Pfam : PF05927 : Penaeidin ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
IPR009226 :
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM
PenaeidinH_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm IDA
GO:0008061 Molecular function Chitin binding IDA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005737 Cellular component Cytoplasm IDA
GO:0008061 Molecular function Chitin binding IDA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0031640 Biological process Killing of cells of another organism IEA
Length : 63
Sequence:
 QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKG
YSG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India