CAMPSQ1076
Title : Esculentin-2HSa
GenInfo Identifier : 224495924
Source : Rana hosii [Hose rock frog]
Taxonomy : Animalia, Amphibia
UniProt: P0C8T9
PubMed : 18621071
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S.aureus ATCC 25923 ( MIC = 32 microM) , E.coli ATCC 25726 ( MIC = 16 microM)
Validated : Experimentally validated
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
AMP Family : Esculentin
Signature :
ID Type Pattern / HMM
EsculentinH37_27 HMM
EsculentinP37_27 Pattern K-x(2)-[AGT]-[KR]-x-G-x(4)-[AGS]-C-K-[AIV]-x(2)-[EQ]-C
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 37
Sequence:
GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India