CAMPSQ10652
Title : Pleurain G1
Source : Rana pleuraden
Taxonomy : Animalia
PubMed : 19028675
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli (MIC = 50microg/ml), S. aureus (MIC = 50microg/ml), Bacillus subtilis (MIC = 100microg/ml), C. albicans (MIC = 12.5microg/ml)
Validated : Experimentally validated
Comment : Possess Anti-oxidant and Anti-inflammatory activity
AMP Family : Brevinin
Signature :
ID Type Pattern / HMM
BrevininH31_4 HMM
BrevininH_224 HMM
Length : 31
Sequence:
GFWDSVKEGLKNAAVTILNKIKCKISECPPA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India