CAMPSQ1054
Title : Fowlicidin-2 , Myeloid antimicrobial peptide 27
GenInfo Identifier : 123894504, 145579366
Source : Gallus gallus [ Chicken]
Taxonomy : Animalia, Aves
UniProt: Q2IAL7
PDB: 2GDL
Structure Database : CAMPST561
PubMed : 16326712, 17229147
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
[E. coli ATCC 25922 (MIC = 2.66 microM), E. coli O157:H7 ATCC 700728 (MIC = 0.66 microM), S. typhimurium ATCC 14028 (MIC = 1.33 microM), S. typhimurium DT104 ATCC 700408 (MIC = 0.66 microM), K. pneumoniae ATCC 13883 (MIC = 0.66 microM), P. aeruginosa 27853 (MIC = 5.32 microM), L. monocytogenes ATCC 19115 (MIC = 1.33 microM), S. aureus ATCC 25923 (MIC = 0.66 microM), S. aureus MRSA ATCC BAA-39 (MIC = 0.66 microM), S. aureus MRSA ATCC 43300 (MIC = 0.33 microM)-0mM Nacl] [E. coli ATCC 25922 (MIC = 2.66 microM), E. coli O157:H7 ATCC 700728 (MIC = 1.33 microM), S. typhimurium ATCC 14028 (MIC = 1.33 microM), S. typhimurium DT104 ATCC 700408 (MIC = 1.33 microM), K. pneumoniae ATCC 13883 (MIC = 1.33 microM), P. aeruginosa 27853 (MIC = 2.66 microM), L. monocytogenes ATCC 19115 (MIC = 1.33 microM), S. aureus ATCC 25923 (MIC = 1.33 microM), S. aureus MRSA ATCC BAA-39 (MIC = 1.33 microM), S. aureus MRSA ATCC 43300 (MIC = 2.66 microM)-100mM Nacl]
Validated : Experimentally validated
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH32_2 HMM
CathelicidinH_140 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IMP
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0019835 Biological process Cytolysis IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0042116 Biological process Macrophage activation IDA
GO:0001818 Biological process Negative regulation of cytokine production IDA
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IMP
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0019835 Biological process Cytolysis IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0042116 Biological process Macrophage activation IDA
GO:0001818 Biological process Negative regulation of cytokine production IDA
Length : 32
Sequence:
LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India