CAMPSQ973
Title : Ostricacin-1
GenInfo Identifier : 145566911
Source : Struthio camelus [Ostrich]
Taxonomy : Animalia, Aves
UniProt: P85113
PubMed : 16459058
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S.aureus 1056 MRSA ( MIC=1.25 microg/ml) , S.aureus NCTC 4163 ( MIC=6.7 microg/ml) , E.coli O157:H7 ( MIC=0.96 microg/ml) , E.coli 0111 ( MIC=6.7 microg/ml)
Validated : Experimentally validated
Comment : Inactive against C.albicans 3153A
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH35_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 36
Sequence:
LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India