| CAMPSQ926 |
| Title : |
Antifungal protein S |
| GenInfo Identifier : |
417989 |
| Source : |
Hordeum vulgare [Barley] |
| Taxonomy : |
Plantae |
| UniProt: |
P33045 |
| PubMed : |
1936240 |
| Activity : |
Antifungal |
| Target : |
Trichoderma viridae , Candida albicans |
| Validated : |
Experimentally validated |
| InterPro : |
IPR001938 : Thaumatin.
|
| AMP Family : |
Thaumatin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
37 |
Sequence: |
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP |
