CAMPSQ925
Title : Antifungal protein R
GenInfo Identifier : 417986
Source : Hordeum vulgare [Barley]
Taxonomy : Plantae
UniProt: P33044
PubMed : 1936240
Activity : Antifungal
Target :
Trichoderma viridae , Candida albicans
Validated : Experimentally validated
InterPro : IPR001938 : Thaumatin.
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM
ThaumatinH_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India