CAMPSQ913
Title : Antifungal protein AX1
GenInfo Identifier : 6225076
Source : Beta vulgaris [Sugar beet]
Taxonomy : Plantae
UniProt: P81493
PubMed : 7655063
Activity : Antifungal
Target :
C. beticola , other filamentous fungii
Validated : Experimentally validated
Comment : Inactive against bacteria
InterPro : IPR008177 : G_Purothionin.
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 46
Sequence:
AICKKPSKFFKGACGRDADCEKACDQENWPGGVCVPFLRCECQRSC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India